PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG031544.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WRKY
Protein Properties Length: 153aa    MW: 17517.8 Da    PI: 10.2104
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG031544.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.89.7e-3376134159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
  CCG031544.1  76 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHQ 134
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-3361134IPR003657WRKY domain
SuperFamilySSF1182901.44E-2968135IPR003657WRKY domain
PROSITE profilePS5081129.58571136IPR003657WRKY domain
SMARTSM007744.0E-3876135IPR003657WRKY domain
PfamPF031062.6E-2677134IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MINSNASTGF EGTRGNGLLE LMQEMQAPAS LNFHDISQNR GFVGSGIEGK LGKNKGEKKI  60
RKPKYAFQTR SRVDILDDGY RWRKYGQKAV KNNKFPRSYY RCTHQGCNVK KQVQRLTKDE  120
GVVVTTYEGM HSHQIEKSPD NFEHILSQMQ IYA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-2866135776Probable WRKY transcription factor 4
1wj2_A2e-2866135776Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3774380.0GQ377438.1 (Populus tomentosa x P. bolleana) x P. tomentosa WRKY transcription factor 18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011020795.11e-113PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA21e-54WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9GVW01e-108B9GVW0_POPTR; Uncharacterized protein
STRINGPOPTR_0003s16750.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.12e-55WRKY DNA-binding protein 75